Protein Info for CA264_00395 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF05401: NodS" amino acids 28 to 120 (93 residues), 37.3 bits, see alignment E=1.2e-12 PF13489: Methyltransf_23" amino acids 31 to 183 (153 residues), 68.3 bits, see alignment E=3e-22 PF01209: Ubie_methyltran" amino acids 39 to 139 (101 residues), 36.7 bits, see alignment E=1.3e-12 PF01135: PCMT" amino acids 40 to 112 (73 residues), 29.1 bits, see alignment E=3.8e-10 PF02353: CMAS" amino acids 40 to 146 (107 residues), 30.3 bits, see alignment E=1.2e-10 PF13847: Methyltransf_31" amino acids 41 to 140 (100 residues), 61.8 bits, see alignment E=2.9e-20 PF13649: Methyltransf_25" amino acids 42 to 132 (91 residues), 79.7 bits, see alignment E=1e-25 PF08241: Methyltransf_11" amino acids 42 to 136 (95 residues), 83.4 bits, see alignment E=6.8e-27 PF08242: Methyltransf_12" amino acids 42 to 134 (93 residues), 68.2 bits, see alignment E=3.9e-22

Best Hits

KEGG orthology group: None (inferred from 60% identity to cpi:Cpin_0221)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMD1 at UniProt or InterPro

Protein Sequence (208 amino acids)

>CA264_00395 SAM-dependent methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSIQQAYNSWASQYDTNKNRTRDLEAVALRATLAGIGFESCLEVGCGTGKNTEWLVRKAQ
HVTGVDLSEEMLERAKKKVNSNKATFVQADITQGWSFATQPYDLVSFSLVLEHIADLEHI
FRKTAAVLRHGGHVYIGELHPFKQYSGTKARFDTEQGRQEVACYTHHVSDFVQAAKQHGL
KLIDLNEYFDDNDRTSIPRILTLLLQRV