Protein Info for CA264_00340 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ZIP family zinc transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 6 to 6 (1 residues), see Phobius details transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 169 to 193 (25 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 69% identity to npu:Npun_F2202)

Predicted SEED Role

"putative integral membrane protein."

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY11 at UniProt or InterPro

Protein Sequence (249 amino acids)

>CA264_00340 ZIP family zinc transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MPLWLQAGLYGLLAGLALVVGAVTGCFVPIKQRVVAGIMAFGSGVLVSALSFELMGEAYE
RGGFDATVVGFLAGAAIYTFANWVLAKQGAKHRKRSGKQQPSESEESGSGMALAIGSLID
GIPEAMVIGISMIAGGAVSMVALIAVCLSNVPEGLSSAVGMKNAGRSKAYIFGVWGSIAL
ILGFASLAGYTVFSGLPDDVIAATTALAAGAILAMVSDTMIPEAFEQAHNMTGLITVLGF
LVAFVLSHL