Protein Info for CA264_00335 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 192 to 218 (27 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details PF00375: SDF" amino acids 6 to 420 (415 residues), 427.9 bits, see alignment E=2e-132

Best Hits

KEGG orthology group: None (inferred from 60% identity to rmr:Rmar_0956)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMB4 at UniProt or InterPro

Protein Sequence (434 amino acids)

>CA264_00335 dicarboxylate/amino acid:cation symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKLALHWQILIGMALGVLWGMLASYLGLVEFTSDWVKPFGTIFINLLKLIAVPLVLVSL
ITGVSSLSDVSRLSRIGSKTIGIYLMTTVVAVVLGLVLVNVFEPGKAFSPEKREEFKEQF
ASTTVEKSSDAAAVEQQGPLQPLIDIVPSNIFGSLTTNSAMLQVIFFALLFGVALIMIPA
DKAQPVNDFFEGVNLVILQIVDLIMATAPYGVFALLAGLVVEFAGDDPGAAVELLLVLGY
YCIVVIVGLALMIFVVYPLLVTTVGKTKYKSFFKGIFPAQMLAFSTSSSAATLPVTMECA
EQNLGINKEITSFVLPLGATINMDGTSLYQAVAAVFIAQAYGIQLDIMAQLGIVMTATLA
SIGAAAVPGAGIVMLVIVLQQAGIPIEGIALILAPDRILDMLRTTVNVTGDATVSMMVAR
TEGQLHPPKETTAV