Protein Info for CA264_00280 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DegT/DnrJ/EryC1/StrS aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 44% identical to FDTB_ANETH: dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (fdtB) from Aneurinibacillus thermoaerophilus

KEGG orthology group: None (inferred from 52% identity to hhy:Halhy_3296)

MetaCyc: 44% identical to dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose transaminase (Thermoanaerobacterium thermosaccharolyticum)
RXN-12810 [EC: 2.6.1.89]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffA"

MetaCyc Pathways

dTDP-α-D-mycaminose biosynthesis (3/5 steps found)
dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (3/5 steps found)
superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMA8 at UniProt or InterPro

Protein Sequence (370 amino acids)

>CA264_00280 DegT/DnrJ/EryC1/StrS aminotransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQPLPYFQFRDFPAGLEAQVQQALAEAVAAKQYVLGPQVQAFEGEFARFIGAGSAVGVGN
GYDALVIALKALGIGPGDEVVLPVHTFIATVNAVLQVGAKPVLAEPDRYTYNLTADTAAR
HLSPRTKAVLPVHLYGQVCEMDELLQVAQLQGIKVLEDVAQAHGATYKSRLAGSFGDAAA
FSFYPTKNLGAVGDAGAVVSSDASVAAFARKYRNYGEAQKYRSEQVGVNSRLDELQAAVL
RVKLPHLQALNTERQRLAHVYLQELQQTGDIILPVSVPGCGHVYHIFNIRTRHRDALQVY
LQEQGIGAAVHYPVPVHQQPAYTFLGYKASDFPVAEELANTSLSLPLFPGLTELEQERVL
EAVKRFCRKR