Protein Info for CA264_00275 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05523: FdtA
  • amino acids 7 to 131 (125 residues), 128.3 bits, E=8.5e-42

Best Hits

Swiss-Prot: 44% identical to FDTA_ANETH: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (fdtA) from Aneurinibacillus thermoaerophilus

KEGG orthology group: None (inferred from 44% identity to chu:CHU_2509)

MetaCyc: 44% identical to dTDP-6-deoxy-3,4-keto-hexulose isomerase (Aneurinibacillus thermoaerophilus L420-91)
RXN-12839 [EC: 5.3.2.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

• dTDP-3-acetamido-α-D-fucose biosynthesis (3/5 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (3/6 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.3

Sequence Analysis Tools

See A0A1X9YM90 at UniProt or InterPro

Protein Sequence (137 amino acids)

>CA264_00275 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MPAKPHLLSFDCIGSPHAGYITSTQLAKNIPFEIKRVFWTQATPPTVARGHHANMATEEV
LVALSGSIQVLTDTGREQQEFELAHPQQGLYIPAMCWTELHFSEGATALCLASTDFSETD
YIRDYDRFLKLASHNAL