Protein Info for CA264_00170 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ATP:cob(I)alamin adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01923: Cob_adeno_trans
  • amino acids 3 to 168 (166 residues), 210.6 bits, E=8.4e-67
• TIGR00636: ATP:cob(I)alamin adenosyltransferase
  • amino acids 4 to 181 (178 residues), 184.7 bits, E=5.7e-59

Best Hits

KEGG orthology group: None (inferred from 68% identity to dfe:Dfer_3302)

Predicted SEED Role

"ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" (EC 2.5.1.17)

MetaCyc Pathways

• adenosylcobalamin salvage from cobalamin (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (3/5 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (3/6 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (3/6 steps found)
• cobalamin salvage (eukaryotic) (4/8 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (4/8 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (4/9 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (13/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (13/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

See A0A1X9YM84 at UniProt or InterPro

Protein Sequence (184 amino acids)

>CA264_00170 ATP:cob(I)alamin adenosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKIYTKTGDKGTTALIGGTRVAKSHLRIEAYGTVDELNSYIGLVRDQEVNAARLDILKEI
QDRLFTIGALLATDPEKSKMKTPDLHEEDVTLLEQEIDLMTADVPPLRAFVLPGGHQSVS
FCHVARCVCRRAERLAISLQEVAAVAEGELVVKYLNRLSDYLFALCRKMTQELGAEEVVW
KPRI