Protein Info for CA264_00105 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: nucleotidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 PF00027: cNMP_binding" amino acids 39 to 123 (85 residues), 55.3 bits, see alignment E=1.1e-18 PF00571: CBS" amino acids 179 to 227 (49 residues), 33.4 bits, see alignment 9.2e-12 amino acids 238 to 294 (57 residues), 36.5 bits, see alignment 1e-12 PF03445: DUF294" amino acids 321 to 460 (140 residues), 165.4 bits, see alignment E=1.4e-52 PF10335: DUF294_C" amino acids 497 to 637 (141 residues), 117.7 bits, see alignment E=7.5e-38

Best Hits

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YM77 at UniProt or InterPro

Protein Sequence (643 amino acids)

>CA264_00105 nucleotidyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKPANAIQERVLEFLKQYPPFNLIAQDELRQLAGQVRVQYLEPEQVLFKQGDTPHEVFYV
VRQGSVRLEQGPEDERRLVDVCDEGDVFGARALIAKKDYSSRATAAEEALVYGIPTALFE
PILYHNPEVALYFAAGFAAGSPVQQGSMQETNKARRGLSTYTPQQPLHLEDVLTLDTDRN
KVTCTGQTSIRLAAQIMSDKDSSFILVVDEQERPVGILTDTDLRRRVVAGHLSIDDAVTE
VMSAPVVTIHPNPHMAEALLLMMRHRIKHLCVTADGSGESPVEGVLTEHHLLLAQGNNPA
VLVQEIRETQSIGNLPAIRNQAEELLQKYLEQEVSIAFIANIITEINDALVVRALRHAES
VLGEPPLRYCWLSIGSEGREEQLLRTDQDNALVFEDAHAAQEKEAQAYFLELAAQVNQVL
ESCGFERCPANMMASNPLWCQPLHTWVHYFYKWIHQPTEEALLNASIFFDYRPVYGDFSL
AEKLTNYVYEHIQQERIFLPYLAKHALQSPPPLSFFRSFIVERGGEHKDQFDIKLRAMAP
LVDAARVLTLDNRVAGENNTFKRFARLAALEPQNAGLYQEAAMAYEIMMRHRALSGLRNH
NSGRYINPEQLNKLERQTLRNTFKPISDVQELLQVRFQLNYLG