Protein Info for CA264_00080 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation acetate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 372 to 398 (27 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details amino acids 444 to 468 (25 residues), see Phobius details amino acids 477 to 496 (20 residues), see Phobius details amino acids 509 to 532 (24 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 7 to 553 (547 residues), 883.5 bits, see alignment E=2.5e-270 PF00474: SSF" amino acids 33 to 301 (269 residues), 127.5 bits, see alignment E=3.2e-41 amino acids 369 to 484 (116 residues), 66.7 bits, see alignment E=9.3e-23

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 72% identity to amc:MADE_00721)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YM74 at UniProt or InterPro

Protein Sequence (563 amino acids)

>CA264_00080 cation acetate symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSILAWTYLIVGITFALYIGIAIWSRAGSTKEFYVAGGGVSPLANGMATAADWMSAASFI
SMAGLISFMGYDGSVYLMGWTGGYVLLALLLAPYLRKFGKFTVPDFVGDRYYSRTARLVA
VVCAIFISFTYVAGQMRGVGIVFSRFLEVQIETGVIIGMVIVLFYAVLGGMKGITYTQVA
QYCVLIFAYMVPAIFISIMLTGNPIPQLGLGGDVADGTPLLAKLDGMLTELGFAPYTSGT
KSTIDVFFITAALMVGTAGLPHVIVRFFTVPKVKDARKSAGYALVFIAILYTTAPAIGAF
GRYNMINNISNRPIAEMPRWVQNWQKTKLISIEDRNGDGRIQYVKNPDVNELTIDKDIMV
LANPEIANLPNWVIALVAAGGLAAALSTAAGLLLVISTSISHDLLKNSFMPDISEKSELI
AARVAATLAVVVAGYFGIYPPGFVAEVVAFAFGLAAASFFPVIIMGIFSTRMNKQGAIWG
MVIGLLFTISYISYFKFINPDANLPENWWFGISPEGIGTLGMVLNFIVSFVISRMTPPPP
AHIQELVEDIRIPRGVVAAAAAH