Protein Info for CA264_00055 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ATP-dependent protease ATP-binding subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 8 to 464 (457 residues), 638.1 bits, see alignment E=4.1e-196 PF00004: AAA" amino acids 57 to 110 (54 residues), 26 bits, see alignment 2.8e-09 amino acids 254 to 352 (99 residues), 32.7 bits, see alignment E=2.3e-11 PF07724: AAA_2" amino acids 204 to 348 (145 residues), 95 bits, see alignment E=1.3e-30 PF10431: ClpB_D2-small" amino acids 354 to 428 (75 residues), 25.7 bits, see alignment E=2.4e-09

Best Hits

Swiss-Prot: 74% identical to HSLU_CYTH3: ATP-dependent protease ATPase subunit HslU (hslU) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 77% identity to mtt:Ftrac_0809)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YM66 at UniProt or InterPro

Protein Sequence (464 amino acids)

>CA264_00055 ATP-dependent protease ATP-binding subunit HslU (Pontibacter actiniarum KMM 6156, DSM 19842)
MLDNIASLTPAQIVAELDKYIIGQKDAKRNVAIALRNRWRRMNADKSIQSDIVPNNILMI
GATGVGKTEIARRLAKIADAPFTKVEASKFTEVGYVGRDVESMVRDLVEQSVNMVKQKKK
EEVKQKAAEMVEDIILDALIPPIQGRSGSPVSTTTDPNSMPDNDYELNERTREKFREKIR
NGELEDRKIEIRVSQSAMPGMGVMGPGMDEASMMNIQEMISGMMPKKTKKRKVTIGEARK
ILLEEEASKLIDMDEVKEEAIFKAENSGVIFIDEIDKVASASNKGGGGPDVSREGVQRDL
LPIVEGSTVNTKYGIITTDHILFIAAGAFHVAKPSDLIPELQGRFPIRVELDSLTKDDFY
QILKFPKNALTKQYEALLSSEDVELTFNDEALDEIASIAYEVNTEVENIGARRLHTVMSR
LLNDILFDVPDKIGANAHILVDRAMVQEKLSGMVKNRDLSQYIL