Protein Info for CA264_00005 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: chromosomal replication initiation protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF11638: DnaA_N" amino acids 7 to 67 (61 residues), 74.8 bits, see alignment E=8.9e-25 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 9 to 468 (460 residues), 545.2 bits, see alignment E=6.8e-168 PF00308: Bac_DnaA" amino acids 135 to 353 (219 residues), 288.2 bits, see alignment E=1.3e-89 PF01695: IstB_IS21" amino acids 172 to 274 (103 residues), 33 bits, see alignment E=1.1e-11 PF00004: AAA" amino acids 173 to 265 (93 residues), 22.4 bits, see alignment E=3.7e-08 PF08299: Bac_DnaA_C" amino acids 381 to 448 (68 residues), 99.3 bits, see alignment E=2.6e-32

Best Hits

Swiss-Prot: 48% identical to DNAA_CHLTE: Chromosomal replication initiator protein DnaA (dnaA) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 60% identity to dfe:Dfer_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YM38 at UniProt or InterPro

Protein Sequence (474 amino acids)

>CA264_00005 chromosomal replication initiation protein DnaA (Pontibacter actiniarum KMM 6156, DSM 19842)
MIKDCSTVWNNCLQVIKENIGEQSFKTWFEPIKPVSLRDSVLTIQVPSQFFYEWLEEHYV
QLLKKVIYQELGSEGRLEYSIIVDRGNDGNKPQTVNIPTKRIPAAVVNSYKPEQSFIKSP
FESKTIDRNFLNSQLNPAYTFENYIEGDCNRLARSAGYAVANKPGTTSFNPLMIYGGVGL
GKTHLVQAIGNNIKNSNPEKFVLYVSSEKFVNQFIESVKTNNVQDFANFYLLVDILIIDD
VQFLSGKDKTQEMFFHIFNHLHQSGKQIVMTSDCPPRDLKGLEERLLSRFKWGLTADLQS
PDFETRMAIIQKKMQGDGIDIPDNVVEYLAYSVDTNVRELEGVLISLIAQSSLNRKEIDL
ELAKQALKHIIEDVETEVNLDFIQKTVAEYFQVSLDSLKAKTRKKEIVTARQVAMYFAKE
FTSHSLKSIGYHFGGRDHSTVIHSVQTVSDLIDTDKKFKASIQELQKKFKTKAG