Protein Info for BNILDI_23005 in Escherichia coli ECRC62

Name: iprA
Annotation: hydrogen peroxide resistance inhibitor IprA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF15977: HTH_46" amino acids 138 to 205 (68 residues), 105.3 bits, see alignment E=6.5e-35

Best Hits

Swiss-Prot: 100% identical to IPRA_ECO57: Inhibitor of hydrogen peroxide resistance (iprA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b0375)

Predicted SEED Role

"FIG00637869: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>BNILDI_23005 hydrogen peroxide resistance inhibitor IprA (Escherichia coli ECRC62)
MLSVVKPLQEFGKLDKCLSRYGTRFEFNNEKQVIFSSDVNSEDTFVILEGVISLRREENV
LIGITQAPYIMGLADGLMKNDIPYKLISEGNCTGYHLPAKQTITLIEQNQLWRDAFYWLA
WQNRILELRDVQLIGHNSYEQIRATLLSMIDWNEELRSRIGVMNYIHQRTRISRSVVAEV
LAALRKGGYIEMNKGKLVAINRLPSEY