Protein Info for BNILDI_22820 in Escherichia coli ECRC62

Name: nrdR
Annotation: transcriptional regulator NrdR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR00244: transcriptional regulator NrdR" amino acids 1 to 147 (147 residues), 259.5 bits, see alignment E=4.3e-82 PF03477: ATP-cone" amino acids 50 to 136 (87 residues), 73.7 bits, see alignment E=7.3e-25

Best Hits

Swiss-Prot: 100% identical to NRDR_ECO45: Transcriptional repressor NrdR (nrdR) from Escherichia coli O45:K1 (strain S88 / ExPEC)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 100% identity to eco:b0413)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>BNILDI_22820 transcriptional regulator NrdR (Escherichia coli ECRC62)
MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVPSKMIGNLVMEQLKKLD
KVAYIRFASVYRSFEDIKEFGEEIARLED