Protein Info for BNILDI_22090 in Escherichia coli ECRC62

Name: cusC
Annotation: Cu(+)/Ag(+) efflux RND transporter outer membrane channel CusC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 11 to 457 (447 residues), 377.1 bits, see alignment E=6.4e-117 PF02321: OEP" amino acids 64 to 247 (184 residues), 76.9 bits, see alignment E=8.9e-26 amino acids 274 to 455 (182 residues), 105.2 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 99% identical to CUSC_ECO57: Cation efflux system protein CusC (cusC) from Escherichia coli O157:H7

KEGG orthology group: K07796, Cu(I)/Ag(I) efflux system outer membrane protein CusC (inferred from 100% identity to ecw:EcE24377A_0590)

MetaCyc: 100% identical to copper/silver export system outer membrane channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-90; TRANS-RXN0-280

Predicted SEED Role

"Cation efflux system protein CusC precursor" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>BNILDI_22090 Cu(+)/Ag(+) efflux RND transporter outer membrane channel CusC (Escherichia coli ECRC62)
MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVNAADNYQNAGWRTFFVD
NQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGNTAT
TREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLAY
AQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQANN
ALQLLLGSYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANANIGAA
RAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAEIRQQ
QSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHGAVSYL
EVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQQ