Protein Info for BNILDI_21795 in Escherichia coli ECRC62

Name: tatE
Annotation: deaminated glutathione amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00795: CN_hydrolase" amino acids 3 to 245 (243 residues), 143 bits, see alignment E=5.4e-46

Best Hits

Swiss-Prot: 99% identical to YBEM_ECOBD: Deaminated glutathione amidase (ybeM) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: None (inferred from 100% identity to ecw:EcE24377A_0650)

Predicted SEED Role

"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.4

Use Curated BLAST to search for 3.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>BNILDI_21795 deaminated glutathione amidase (Escherichia coli ECRC62)
MLVAAGQFAVTSVWEKNAEICASLMAQAAENDVSLFVLPEALLARDDHDADLLVKSAQLL
EGEFLGRLRRESKRNMMTTILTIHVPSTPGRAWNMLVALQAGNIVARYAKLHLYDAFAIQ
ESRRVDAGNEIAPLLEVEGMKVGLMICYDLRFPELALAQALQGAEILVLPAAWVRGPLKE
HHWSTLLAARALDTTCYMVAAGECGNKNIGQSRIIDPFGVTIAAASEMPALIMAEVTPER
VRQVRAQLPVLNNRRFAPPQLL