Protein Info for BNILDI_21645 in Escherichia coli ECRC62

Name: gltI
Annotation: glutamate/aspartate ABC transporter substrate-binding protein GltI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 42 to 271 (230 residues), 168.1 bits, see alignment E=2.2e-53

Best Hits

Swiss-Prot: 99% identical to GLTI_ECOLI: Glutamate/aspartate import solute-binding protein (gltI) from Escherichia coli (strain K12)

KEGG orthology group: K10001, glutamate/aspartate transport system substrate-binding protein (inferred from 99% identity to ecw:EcE24377A_0683)

MetaCyc: 99% identical to glutamate/aspartate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>BNILDI_21645 glutamate/aspartate ABC transporter substrate-binding protein GltI (Escherichia coli ECRC62)
MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQ
KVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVER
QKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTTSEVLLNKLNEEQKMNMR
IISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGKPQSQEAYGCMLRK
DDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKEPNDKA
LN