Protein Info for BNILDI_21640 in Escherichia coli ECRC62

Annotation: Rhomboid family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details PF01694: Rhomboid" amino acids 59 to 201 (143 residues), 101.7 bits, see alignment E=2.1e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>BNILDI_21640 Rhomboid family protein (Escherichia coli ECRC62)
MSASSAKPLNVQLPAITLILFALCVGIFCYLAQWMSYEEVDQSALIHLGANVASLTLSGE
SWRLLSSVFLHSSVSHLLMNMFALLVVGGVVERILGKWRLLIIWLFSGVFGGLISACYAL
RESEQIVISVGASGAIMGIAGAAIATQLASGAGTHHKNQRRVFPLLGMVALTLLYGARQT
GIDNACHIGGLIAGGALGWLSARLSGQNRLVTEGGIIVAGSLLLTGAIWLAQQQMDESVL
QVRQSLREAFYPQEIEQERRQKKQQLA