Protein Info for BNILDI_21525 in Escherichia coli ECRC62

Name: chiP
Annotation: chitoporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF03573: OprD" amino acids 33 to 431 (399 residues), 86.8 bits, see alignment E=8.4e-29

Best Hits

Swiss-Prot: 100% identical to CHIP_ECOLI: Chitoporin (chiP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0681)

MetaCyc: 100% identical to chitooligosaccharide outer membrane channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-481

Predicted SEED Role

"N-acetylglucosamine-regulated outer membrane porin" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>BNILDI_21525 chitoporin (Escherichia coli ECRC62)
MRTFSGKRSTLALAIAGVTAMSGFMAMPEARAEGFIDDSTLTGGIYYWQRERDRKDVTDG
DKYKTNLSHSTWNANLDFQSGYAADMFGLDIAAFTAIEMAENGDSSHPNEIAFSKSNKAY
DEDWSGDKSGISLYKAAAKFKYGPVWARAGYIQPTGQTLLAPHWSFMPGTYQGAEAGANF
DYGDAGALSFSYMWTNEYKAPWHLEMDEFYQNDKTTKVDYLHSIGAKYDFKNNFVLEAAF
GQAEGYIDQYFAKASYKFDIAGSPLTTSYQFYGTRDKVDDRSVNDLYDGTAWLQALTFGY
RAADVVDLRLEGTWVKADGQQGYFLQRMTPTYASSNGRLDIWWDNRSDFNANGEKAVFFG
AMYDLKNWNLPGFAIGASYVYAWDAKPATWQSNPDAYYDKNRTIEESAYSLDAVYTIQDG
RAKGTMFKLHFTEYDNHSDIPSWGGGYGNIFQDERDVKFMVIAPFTIF