Protein Info for BNILDI_20505 in Escherichia coli ECRC62

Name: ybjT
Annotation: Putative NAD(P)-binding protein YbjT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 445 to 463 (19 residues), see Phobius details PF01370: Epimerase" amino acids 5 to 119 (115 residues), 55.6 bits, see alignment E=1.4e-18 PF05368: NmrA" amino acids 5 to 150 (146 residues), 34.4 bits, see alignment E=4.1e-12 PF01073: 3Beta_HSD" amino acids 6 to 114 (109 residues), 24 bits, see alignment E=4.7e-09 PF13460: NAD_binding_10" amino acids 9 to 148 (140 residues), 60 bits, see alignment E=7.5e-20 PF11066: DUF2867" amino acids 331 to 463 (133 residues), 53.6 bits, see alignment E=8.1e-18

Best Hits

Swiss-Prot: 100% identical to YBJT_ECOLI: Putative NAD(P)-binding protein YbjT (ybjT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0869)

Predicted SEED Role

"FIG00638862: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>BNILDI_20505 Putative NAD(P)-binding protein YbjT (Escherichia coli ECRC62)
VPQRILVLGASGYIGQHLVRTLSQQGHQILAAARHVDRLAKLQLANVSCHKVDLSWPDNL
PALLQDIDTVYFLVHSMGEGGDFIAQERQVALNVRDALREVPVKQLIFLSSLQAPPHEQS
DHLRARQATADILREANVPVTELRAGIIVGAGSAAFEVMRDMVYNLPVLTPPRWVRSRTT
PIALENLLHYLVALLDHPASEHRIFEAAGPEVLSYQQQFEHFMAVSGKRRWLIPIPLPTR
WISVWFLNVITSVPPTTARALIQGLKHDLLADDTALRALIPQRLIAFDDAVRSTLKEEEK
LVNSSDWGYDAQAFARWRPEYGYFAKQAGFTVKTSASLAALWQVVNQIGGKERYFFGNIL
WQTRALMDRAIGHKLAKGRPEREYLQTGDAVDSWKVIVVEPEKQLTLLFGMKAPGLGRLC
FSLEDKGDYRTIDVRAFWHPHGMPGLFYWLLMIPAHLFIFRGMAKQIARLAEQSTD