Protein Info for BNILDI_20350 in Escherichia coli ECRC62

Name: ycaD
Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 343 to 361 (19 residues), see Phobius details PF07690: MFS_1" amino acids 4 to 308 (305 residues), 97.6 bits, see alignment E=1.1e-31 amino acids 202 to 364 (163 residues), 55.1 bits, see alignment E=9.3e-19 PF06779: MFS_4" amino acids 20 to 355 (336 residues), 39.7 bits, see alignment E=5.8e-14 PF00083: Sugar_tr" amino acids 31 to 169 (139 residues), 30.7 bits, see alignment E=2.4e-11

Best Hits

Swiss-Prot: 100% identical to YCAD_ECOLC: Uncharacterized MFS-type transporter YcaD (ycaD) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K08219, MFS transporter, UMF2 family, putative MFS family transporter protein (inferred from 100% identity to eco:b0898)

Predicted SEED Role

"Hypothetical MFS-type transporter protein YcaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>BNILDI_20350 MFS transporter (Escherichia coli ECRC62)
MLLLSGLLLLTLAIAVLNTLVPLWLAQEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRI
GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
GRLLAAYMMVYYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENH
DSTSITSMLKLRQARLGVNGCIISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAG
ILGQWPIGRLADKFGRLLVLRVQVFVVILGSIAMLSQAAMAPALFILGAAGFTLYPVAMA
WACEKVEHHQLVAMNQALLLSYTVGSLLGPSFTAMLMQNFSDNLLFIMIASVSFIYLLML
LRNAGHTPKPVAHV