Protein Info for BNILDI_20165 in Escherichia coli ECRC62

Name: ssuB
Annotation: aliphatic sulfonates ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 27 to 160 (134 residues), 105.6 bits, E=1.8e-34

Best Hits

Swiss-Prot: 100% identical to SSUB_SHISS: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Shigella sonnei (strain Ss046)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to ssn:SSON_0936)

MetaCyc: 97% identical to aliphatic sulfonate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Protein Sequence (255 amino acids)

>BNILDI_20165 aliphatic sulfonates ABC transporter ATP-binding protein (Escherichia coli ECRC62)
MNTARLNQGTPLLLNAVSKHYAENIVLNQLDLHIPAGQFVAVVGRSGGGKSTLLRLLAGL
ETPTAGDVLAGTTPLAEIQEDTRMMFQDARLLPWKSVIDNVGLGLKGQWRDAARRALAAV
GLENRAGEWPAALSGGQKQRVALARALIHRPGLLLLDEPLGALDALTRLEMQDLIVSLWQ
EHGFTVLLVTHDVSEAVAMADRVLLIEEGKIGLDLTVDIPRPRRLGSVRLAELEAEVLQR
VMRRGHSEQLIRRHG