Protein Info for BNILDI_20145 in Escherichia coli ECRC62

Name: ssuE
Annotation: NADPH-dependent FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 1 to 141 (141 residues), 121.6 bits, E=2.2e-39
• PF02525: Flavodoxin_2
  • amino acids 1 to 92 (92 residues), 29.4 bits, E=6.6e-11
• TIGR03567: FMN reductase
  • amino acids 2 to 171 (170 residues), 244.5 bits, E=2.9e-77

Best Hits

Swiss-Prot: 100% identical to SSUE_ECOLI: FMN reductase (NADPH) (ssuE) from Escherichia coli (strain K12)

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 100% identity to eco:b0937)

MetaCyc: 100% identical to NADPH-dependent FMN reductase (Escherichia coli K-12 substr. MG1655)
RXN-12444 [EC: 1.5.1.38]

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

• two-component alkanesulfonate monooxygenase (2/2 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (2/3 steps found)
• dibenzothiophene desulfurization (1/5 steps found)
• bacterial bioluminescence (3/8 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (17/33 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.29

Use Curated BLAST to search for 1.5.1.29 or 1.5.1.38

Protein Sequence (191 amino acids)

>BNILDI_20145 NADPH-dependent FMN reductase (Escherichia coli ECRC62)
MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTF
TEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYA
LKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALHRRDVQVP
DLLSLRGNAHA