Protein Info for BNILDI_20100 in Escherichia coli ECRC62

Annotation: glycosyltransferase family 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF13439: Glyco_transf_4" amino acids 14 to 220 (207 residues), 59.7 bits, see alignment E=9.4e-20 PF13579: Glyco_trans_4_4" amino acids 14 to 216 (203 residues), 41.3 bits, see alignment E=5.3e-14 PF00534: Glycos_transf_1" amino acids 223 to 377 (155 residues), 98.2 bits, see alignment E=1e-31 PF13692: Glyco_trans_1_4" amino acids 231 to 363 (133 residues), 93 bits, see alignment E=5.1e-30 PF13524: Glyco_trans_1_2" amino acids 304 to 392 (89 residues), 41.4 bits, see alignment E=3.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecl:EcolC_3179)

Predicted SEED Role

"Putative glycosyltransferase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>BNILDI_20100 glycosyltransferase family 1 protein (Escherichia coli ECRC62)
MKILLVNKFFFIKGGAETVYFQERNWLKAAGVDVVDFSMLHEKNFPSEYADTFVRNVDYH
KESTLLGEVKTASNFIHNAEACRKMRTLLQRERPDIVHFHNIYHQLTPALIKVARNFGCK
TVLTAHDYKIACPAYSMLRDGKVCDACLTGTVFNAFRYRCQEGSATKSLLLSLEATWQSI
ARNYHMLDVIISPSEFLKGILRRKLPHSRIDVIVNGVDDDPATDKTADKGYLLYVGRLSR
EKGVATLPLAHQKMRNRAPLKVVGHGPLYDELVANYPDVEFLGYVQQGEALNTLIKEARA
VILPSECYENCSMSVLEAMSFAKPVIGSRIGGIPEQIRDGIDGVLFEPGNVQDLANAMDY
MIDSPEKARVMGLSARERLREKYTLQKHMETLTALYKEILSWS