Protein Info for BNILDI_19775 in Escherichia coli ECRC62

Name: torS
Annotation: TMAO reductase system sensor histidine kinase/response regulator TorS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 899 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 316 to 337 (22 residues), see Phobius details TIGR02956: TMAO reductase sytem sensor TorS" amino acids 1 to 791 (791 residues), 881.4 bits, see alignment E=4.5e-269 PF21689: TorS_sensor_domain" amino acids 31 to 301 (271 residues), 295.3 bits, see alignment E=1.5e-91 PF00672: HAMP" amino acids 337 to 388 (52 residues), 28.3 bits, see alignment 5.4e-10 PF00512: HisKA" amino acids 428 to 493 (66 residues), 66.7 bits, see alignment 4.8e-22 PF02518: HATPase_c" amino acids 542 to 648 (107 residues), 96.3 bits, see alignment E=4.8e-31 PF00072: Response_reg" amino acids 670 to 777 (108 residues), 53.1 bits, see alignment E=1e-17 PF01627: Hpt" amino acids 812 to 889 (78 residues), 47.3 bits, see alignment E=6e-16

Best Hits

Swiss-Prot: 99% identical to TORS_ECOLI: Sensor protein TorS (torS) from Escherichia coli (strain K12)

KEGG orthology group: K07647, two-component system, OmpR family, sensor histidine kinase TorS [EC: 2.7.13.3] (inferred from 99% identity to ecr:ECIAI1_1036)

MetaCyc: 99% identical to sensor histidine kinase TorS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein torS (EC 2.7.3.-)" in subsystem trimethylamine N-oxide (TMAO) reductase (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (899 amino acids)

>BNILDI_19775 TMAO reductase system sensor histidine kinase/response regulator TorS (Escherichia coli ECRC62)
MALLTLTSTLVGWYNLRFISQVEKDNTQALIPTMNMARQLSEASAWELFAAQNLTSADNE
KMWQAQGRMLTAQSLKINALLQALREQGFDTTAIEQQEQEISRSLRQQGELVGRRLQLRQ
QQQQLSQQIVAAADEIARLAQGQANNAATSAGATQAGIYDLIEQDQRQAAESALDRLIDI
DLEYVNQMNELRLSALRVQQMVMNLGLEQIQKNAPTLEKQLNNAVKILQRRQIRIEDPGV
RAQVATTLTTVSQYSDLLALYQQDSEISNHLQTLAQNNIAQFAQFSSEVSQLVDTIELRN
QHGLAHLEKASARGQYSLLLLGMVSLCALILILWRVVYRSVTRPLAEQTQALQRLLDGDI
DSPFPETAGVRELDTIGRLMDAFRSNVHALNRHREQLAAQVKARTAELQELVIEHRQARA
EAEKASQAKSAFLAAMSHEIRTPLYGILGTAQLLADNPALNAQRDDLRAITDSGESLLTI
LNDILDYSAIEAGGKNVSVSDEPFEPRPLLESTLQLMSGRVKGRPIRLATAIADDMPCAL
MGDPRRIRQVITNLLSNALRFTDEGYIILRSRTDGEQWLVEVEDSGCGIDPAKLAEIFQP
FVQVSGKRGGTGLGLTISSRLAQAMGGELSATSTPEVGSCFCLRLPLRVATAPVPKTVNQ
AVRLDGLRLLLIEDNPLTQRITVEMLNTSGAQVVAIGNAAQALETLQNSEPFAAALVDFD
LPDIDGITLARQLAQQYPSLVLIGFSAHVIDETLRQRTSSLFRGIIPKPVPREVLGQLLA
HYLQLQVNNDQSLDVSQLNEDAQLMGTEKIHEWLVLFTQHALPLLDEIDIARASQDSEKI
KRAAHQLKSSCSSLGMRIASQLCAQLEQQPLSAPLPHEEITRSVADLEAWLNKKDLNAI