Protein Info for BNILDI_19085 in Escherichia coli ECRC62

Name: phoQ
Annotation: two-component system sensor histidine kinase PhoQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 35 to 37 (3 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details PF08918: PhoQ_Sensor" amino acids 10 to 188 (179 residues), 291.8 bits, see alignment E=3.2e-91 PF26769: HAMP_PhoQ" amino acids 218 to 263 (46 residues), 33.6 bits, see alignment 4.5e-12 PF02518: HATPase_c" amino acids 375 to 475 (101 residues), 61.6 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 100% identical to PHOQ_ECOLI: Sensor protein PhoQ (phoQ) from Escherichia coli (strain K12)

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 100% identity to eco:b1129)

MetaCyc: 100% identical to sensor histidine kinase PhoQ (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>BNILDI_19085 two-component system sensor histidine kinase PhoQ (Escherichia coli ECRC62)
MKKLLRLFFPLSLRVRFLLATAAVVLVLSLAYGMVALIGYSVSFDKTTFRLLRGESNLFY
TLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFH
EIEADVNDTSLLLSGDHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDT
IPVELKSSYMVWSWFIYVLSANLLLVIPLLWVAAWWSLRPIEALAKEVRELEEHNRELLN
PATTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSLRSEKMSV
SDAEPVMLEQISRISQQIGYYLHRASMRGGTLLSRELHPVAPLLDNLTSALNKVYQRKGV
NISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGI
PLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQH
SAPKDE