Protein Info for BNILDI_18685 in Escherichia coli ECRC62

Name: narX
Annotation: nitrate/nitrite two-component system sensor histidine kinase NarX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00072: Response_reg" amino acids 9 to 120 (112 residues), 106.7 bits, see alignment E=1.9e-34 PF08281: Sigma70_r4_2" amino acids 153 to 198 (46 residues), 35.8 bits, see alignment 1.3e-12 PF04545: Sigma70_r4" amino acids 154 to 199 (46 residues), 26.5 bits, see alignment 9e-10 PF00196: GerE" amino acids 155 to 209 (55 residues), 80.1 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 100% identical to NARL_ECOLI: Nitrate/nitrite response regulator protein NarL (narL) from Escherichia coli (strain K12)

KEGG orthology group: K07684, two-component system, NarL family, nitrate/nitrite response regulator NarL (inferred from 100% identity to eco:b1221)

MetaCyc: 100% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>BNILDI_18685 nitrate/nitrite two-component system sensor histidine kinase NarX (Escherichia coli ECRC62)
MSNQEPATILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDL
NMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKAL
HQAAAGEMVLSEALTPVLAASLRANRATTERDVNQLTPRERDILKLIAQGLPNKMIARRL
DITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF