Protein Info for BNILDI_18230 in Escherichia coli ECRC62

Name: pspD
Annotation: phage shock protein PspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 73 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details PF09584: Phageshock_PspD" amino acids 11 to 71 (61 residues), 127.8 bits, see alignment E=6.3e-42 TIGR02979: phage shock protein PspD" amino acids 13 to 71 (59 residues), 120 bits, see alignment E=1.9e-39

Best Hits

Swiss-Prot: 100% identical to PSPD_ECO57: Phage shock protein D (pspD) from Escherichia coli O157:H7

KEGG orthology group: K03971, phage shock protein D (inferred from 100% identity to eco:b1307)

Predicted SEED Role

"Phage shock protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (73 amino acids)

>BNILDI_18230 phage shock protein PspD (Escherichia coli ECRC62)
MNTRWQQAGQKVKPGFKLAGKLVLLTALRYGPAGVAGWAIKSVARRPLKMLLAVALEPLL
SRAANKLAQRYKR