Protein Info for BNILDI_18120 in Escherichia coli ECRC62

Name: ycjY
Annotation: Uncharacterized protein YcjY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF02129: Peptidase_S15" amino acids 17 to 162 (146 residues), 34.1 bits, see alignment E=5.9e-12 PF01738: DLH" amino acids 31 to 135 (105 residues), 30.1 bits, see alignment E=8.8e-11 PF00561: Abhydrolase_1" amino acids 37 to 287 (251 residues), 30.6 bits, see alignment E=6.8e-11 PF00326: Peptidase_S9" amino acids 58 to 131 (74 residues), 23.6 bits, see alignment E=8.4e-09

Best Hits

Swiss-Prot: 99% identical to YCJY_ECOLI: Uncharacterized protein YcjY (ycjY) from Escherichia coli (strain K12)

KEGG orthology group: K06889, (no description) (inferred from 99% identity to eco:b1327)

Predicted SEED Role

"Dienelactone hydrolase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>BNILDI_18120 Uncharacterized protein YcjY (Escherichia coli ECRC62)
MMNNKVSFTNSNNPTISLSAVIYFPPKFDETRQYQAIVVSHPGGGVKEQTAGTYAKKLAE
KGFVTIAYDASYQGESGGEPRQLENPYIRTEDISAVIDYLTTLSYVDNTRIGAMGICAGA
GYTANAAIQDRRIKAIGTVSAVNIGSMFRNGWENNVKSIDALPYVEAGSNARTSDISSGE
YAIMPLAPMKESDAPNEELRQAWEYYHTPRAQYPTAPGYATLRSLNQIITYDAYHMAEVY
LTQPTQIVAGSQAGSKWMSDDLYDRASSQDKRYHIVEGANHMDLYDGKAYVAEAISVLAP
FFEETL