Protein Info for BNILDI_17935 in Escherichia coli ECRC62

Name: paaC
Annotation: phenylacetate-CoA oxygenase subunit PaaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF05138: PaaA_PaaC" amino acids 2 to 248 (247 residues), 326.2 bits, see alignment E=6.7e-102 TIGR02158: phenylacetate-CoA oxygenase, PaaI subunit" amino acids 11 to 248 (238 residues), 371.6 bits, see alignment E=9.7e-116

Best Hits

Swiss-Prot: 100% identical to PAAC_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit C (paaC) from Escherichia coli (strain K12)

KEGG orthology group: K02611, phenylacetic acid degradation protein (inferred from 100% identity to eco:b1390)

MetaCyc: 100% identical to phenylacetyl-CoA 1,2-epoxidase, structural subunit (Escherichia coli K-12 substr. MG1655)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaI subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>BNILDI_17935 phenylacetate-CoA oxygenase subunit PaaC (Escherichia coli ECRC62)
MNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELA
GEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLA
AISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAIDKLWRFTAELFDADEIDIALS
EEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQ
RVLPGQQW