Protein Info for BNILDI_17930 in Escherichia coli ECRC62

Name: paaD
Annotation: phenylacetate degradation protein PaaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF01883: FeS_assembly_P" amino acids 14 to 74 (61 residues), 38.6 bits, see alignment E=4.9e-14 TIGR02159: phenylacetate-CoA oxygenase, PaaJ subunit" amino acids 22 to 165 (144 residues), 239.8 bits, see alignment E=6.2e-76

Best Hits

Swiss-Prot: 99% identical to PAAD_ECOLI: Putative 1,2-phenylacetyl-CoA epoxidase, subunit D (paaD) from Escherichia coli (strain K12)

KEGG orthology group: K02612, phenylacetic acid degradation protein (inferred from 99% identity to eco:b1391)

MetaCyc: 38% identical to anthraniloyl-[acp] 1,2-epoxidase subunit K (Streptomyces sp. S4(2010))
1.14.13.-

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaJ subunit"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>BNILDI_17930 phenylacetate degradation protein PaaD (Escherichia coli ECRC62)
MQRLATIAPPQVHEIWALLSQIPDPEIPVLTITDLGMVRNVTQMGEGWVIGFTPTYSGCP
ATEHLIGAIREAMTTHGFTPVQVVLQLDPAWTTDWMTPDARERLRQYGISPPAGHSCHAH
LPPEVRCPRCASVHTTLISEFGSTACKALYRCDSCREPFDYFKCI