Protein Info for BNILDI_17900 in Escherichia coli ECRC62

Name: paaJ
Annotation: bifunctional 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02430: 3-oxoadipyl-CoA thiolase
  • amino acids 2 to 401 (400 residues), 741 bits, E=3.4e-227
• PF00108: Thiolase_N
  • amino acids 5 to 269 (265 residues), 247.9 bits, E=1.8e-77
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 6 to 399 (394 residues), 459.3 bits, E=1e-141
• PF02803: Thiolase_C
  • amino acids 277 to 400 (124 residues), 155.8 bits, E=5.9e-50

Best Hits

Swiss-Prot: 100% identical to PAAJ_ECOLX: Beta-ketoadipyl-CoA thiolase (paaJ) from Escherichia coli

KEGG orthology group: K02615, acetyl-CoA acetyltransferase [EC: 2.3.1.-] (inferred from 99% identity to eco:b1397)

MetaCyc: 99% identical to beta-ketoadipyl-CoA thiolase (Escherichia coli K-12 substr. MG1655)
RXN0-6512 [EC: 2.3.1.223]; 3-oxoadipyl-CoA thiolase. [EC: 2.3.1.223, 2.3.1.174]

Predicted SEED Role

"Phenylacetic acid degradation protein PaaE, ketothiolase"

MetaCyc Pathways

• superpathway of phenylethylamine degradation (11/11 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)
• adipate degradation (5/5 steps found)
• adipate biosynthesis (4/5 steps found)
• 3-oxoadipate degradation (1/2 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• superpathway of salicylate degradation (2/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (1/6 steps found)
• 4-methylcatechol degradation (ortho cleavage) (1/7 steps found)
• aromatic compounds degradation via β-ketoadipate (1/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (1/11 steps found)
• mandelate degradation to acetyl-CoA (4/18 steps found)
• superpathway of aerobic toluene degradation (4/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (5/35 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.174 or 2.3.1.223

Protein Sequence (401 amino acids)

>BNILDI_17900 bifunctional 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase (Escherichia coli ECRC62)
MREAFICDGIRTPIGRYGGALSGVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQA
GEDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESM
SRAPFVMGKATNAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISRED
QDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKA
PFRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGPV
PATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLG
MSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILERV