Protein Info for BNILDI_17900 in Escherichia coli ECRC62

Name: paaJ
Annotation: bifunctional 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 380 to 398 (19 residues), see Phobius details TIGR02430: 3-oxoadipyl-CoA thiolase" amino acids 2 to 401 (400 residues), 741 bits, see alignment E=3.4e-227 PF00108: Thiolase_N" amino acids 5 to 269 (265 residues), 247.9 bits, see alignment E=1.8e-77 TIGR01930: acetyl-CoA C-acyltransferase" amino acids 6 to 399 (394 residues), 459.3 bits, see alignment E=1e-141 PF02803: Thiolase_C" amino acids 277 to 400 (124 residues), 155.8 bits, see alignment E=5.9e-50

Best Hits

Swiss-Prot: 100% identical to PAAJ_ECOLX: Beta-ketoadipyl-CoA thiolase (paaJ) from Escherichia coli

KEGG orthology group: K02615, acetyl-CoA acetyltransferase [EC: 2.3.1.-] (inferred from 99% identity to eco:b1397)

MetaCyc: 99% identical to beta-ketoadipyl-CoA thiolase (Escherichia coli K-12 substr. MG1655)
RXN0-6512 [EC: 2.3.1.223]; 3-oxoadipyl-CoA thiolase. [EC: 2.3.1.223, 2.3.1.174]

Predicted SEED Role

"Phenylacetic acid degradation protein PaaE, ketothiolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.174 or 2.3.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>BNILDI_17900 bifunctional 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase (Escherichia coli ECRC62)
MREAFICDGIRTPIGRYGGALSGVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQA
GEDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESM
SRAPFVMGKATNAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISRED
QDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKA
PFRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGPV
PATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLG
MSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILERV