Protein Info for BNILDI_17180 in Escherichia coli ECRC62

Annotation: PTS sugar transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02302: PTS_IIB
  • amino acids 3 to 95 (93 residues), 68.8 bits, E=2.6e-23

Best Hits

Swiss-Prot: 41% identical to PTQB_ECOLI: PTS system N,N'-diacetylchitobiose-specific EIIB component (chbB) from Escherichia coli (strain K12)

KEGG orthology group: K02760, PTS system, cellobiose-specific IIB component [EC: 2.7.1.69] (inferred from 99% identity to ecw:EcE24377A_1739)

MetaCyc: 41% identical to N,N'-diacetylchitobiose-specific PTS enzyme IIB component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-155B [EC: 2.7.1.196]

Predicted SEED Role

"PTS system, cellobiose-specific IIB component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.196 or 2.7.1.69

Protein Sequence (103 amino acids)

>BNILDI_17180 PTS sugar transporter subunit IIB (Escherichia coli ECRC62)
MKKILLVCAAGMSTSMLVKRMIDHANAISLEVNISALAIAEAKGKIKNNEVDVVLLGPQV
RFQKPEIEAVAQGKMPVAVIEMKDYGTMNGQAVLEFAMKLLQE