Protein Info for BNILDI_17165 in Escherichia coli ECRC62

Name: ydeE
Annotation: efflux MFS transporter YdeE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 342 (330 residues), 108.6 bits, see alignment E=1.7e-35

Best Hits

Swiss-Prot: 99% identical to YDEE_ECOLI: Uncharacterized MFS-type transporter YdeE (ydeE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1534)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>BNILDI_17165 efflux MFS transporter YdeE (Escherichia coli ECRC62)
MNLSLRRSTSALLASSLLLTIGRGATLPFMTIYLSRQYSLSVDLIGYAMTIALTIGVVFS
LGFGILADKFDKKRYMLLAITAFASGFIAIPLVNNVTLVVLFFALINCAYSVFATVLKAW
FADNLSSTSKTKIFSINYTMLNIGWTIGPPLGTLLVMQSINLPFWLAAICSAFPILFIQI
WVKRSEKIIATETGSVWSPKVLLQDKALLWFTCSGFLASFVSGAFASCISQYVMVIADGD
FAEKVVAVVLPVNAAMVVTLQYSVGRRLNPANIRALMTAGTLCFVIGLVGFIFSGNSLLL
WGMSAAVFTVGEIIYAPGEYMLIDHIAPPGMKASYFSAQSLGWLGAAINPLVSGVVLTSL
PPSSLFVILALVIIAAWVLMLKGIRARPWGQPALC