Protein Info for BNILDI_16515 in Escherichia coli ECRC62

Name: uhpC
Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 335 (318 residues), 99.9 bits, see alignment E=7.1e-33

Best Hits

Swiss-Prot: 99% identical to YDIN_ECOLI: Inner membrane transport protein YdiN (ydiN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1691)

Predicted SEED Role

"FIG00638001: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>BNILDI_16515 MFS transporter (Escherichia coli ECRC62)
MSQNKAFSTPFILAVLCIYFSYFLHGISVITLAQNMSSLAEKFSTDNAGIAYLISGIGLG
RLISILFFGVISDKFGRRTVILMAVIMYLLFFFGIPACPNLTLAYGLAVCVGIANSALDT
GGYPALMECFPKASGSAVILVKAMVSFGQMFYPMLVSYMLLNNIWYGYGLIIPGILFVLI
TLMLLKSKFPSQLVDASVANELPQMNSKPLVWLEGVSSVLFGVAAFSTFYVIVVWMPKYA
MAFAGMSEAEALKTISYYSMGSLVCVFIFAALLKKMVRPIWANVFNSALATITAAIIYLY
PSPLVCNAGAFVIGFSAAGGILQLGVSVMSEFFPKSKAKVTSIYMMMGGLANFVIPLITG
YLSNIGLQYIIVLDFTFALLALITAIIVFIRYYRVFIIPENDVRFGERKFSTRLNTIKHR
G