Protein Info for BNILDI_16010 in Escherichia coli ECRC62

Name: dgcJ
Annotation: diguanylate cyclase DgcJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 306 to 328 (23 residues), see Phobius details PF17155: GAPES1" amino acids 31 to 304 (274 residues), 501.4 bits, see alignment E=6.3e-155 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 343 to 495 (153 residues), 120.6 bits, see alignment E=2.7e-39 PF00990: GGDEF" amino acids 346 to 494 (149 residues), 137.1 bits, see alignment E=4.9e-44

Best Hits

Swiss-Prot: 100% identical to DGCJ_ECOLI: Probable diguanylate cyclase DgcJ (dgcJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1786)

MetaCyc: 100% identical to diguanylate cyclase DgcJ (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"Putative two-component response regulator and GGDEF family protein YeaJ" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>BNILDI_16010 diguanylate cyclase DgcJ (Escherichia coli ECRC62)
MKLHHRMLRHFIAASVIVLTSSFLIFELVASDRAMSAYLRYIVQKADSSFLYDKYQNQSI
AAHVMRALAAEQSEVSPEQRRAICEAFESANNTHGLNLTAHKYPGLRGTLQTASTDCDTI
VEAAALLPAFDQAVEGNRHQDDYGSGLGMAEEKFHYYLDLNDRYVYFYEPVNVEYFAMNN
WSFLQSGSIGIDRKDIEKVFTGRTVLSSIYQDQRTKQNVMSLLTPVYVAGQLKGIVLLDI
NKNNLRNIFYTHDRPLLWRFLNVTLTDTDSGRDIIINQSEDNLFQYVSYVHDLPGGIRVS
LSIDILYFITSSWKSVLFWILTALILLNMVRMHFRLYQNVSRENISDAMTGLYNRKILTP
ELEQRLQKLVQSGSSVMFIAIDMDKLKQINDTLGHQEGDLAITLLAQAIKQSIRKSDYAI
RLGGDEFCIILVDSTPQIAAQLPERIEKRLQHIAPQKEIGFSSGIYAMKENDTLHDAYKA
SDERLYVNKQNKNSRS