Protein Info for BNILDI_15585 in Escherichia coli ECRC62

Annotation: maltose ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01547: SBP_bac_1
  • amino acids 42 to 321 (280 residues), 100.3 bits, E=2.2e-32
• PF13416: SBP_bac_8
  • amino acids 50 to 339 (290 residues), 102.1 bits, E=5e-33

Best Hits

KEGG orthology group: K10108, maltose/maltodextrin transport system substrate-binding protein (inferred from 99% identity to sbc:SbBS512_E2135)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization

Protein Sequence (410 amino acids)

>BNILDI_15585 maltose ABC transporter substrate-binding protein (Escherichia coli ECRC62)
MKLSNIVTVIILAISSTLTPQAMAEKLIPETDAELLVWSDATSAEYMKYAAKEFNKDFGY
KVKFTFRNIAPMDAASRIMQDGGTTRVADVAEIEHDTLGWLVVAGGVMENMVSAERIKKT
FIPGAVSAATYNNISYGFPVSFATLALFYNKDLLNTAPKTFEEINTFSEKFNNSSEHKYA
LLWDVQNYYVSRMFITLYGANEFGKTGNDPKALGIASSEAKKGLETMKRLKKANPSNPLD
MGNPQVLRGLFNEGKVAAVIDGPWSIQGYIDSGINFGVTRIPTLDGHQPRTFSTVRLAVV
SSFTEYPHAAELFADYLTTDKMLMKRYEMTNLIPPINSLMNKISQTGSEAIKAIIAQANY
SDAMPSIPEMSYLWSPMTNAILATWVENKTPDEVLNHAQTIIEEQLSLQE