Protein Info for BNILDI_15545 in Escherichia coli ECRC62

Name: lpxM
Annotation: lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details TIGR02208: lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase" amino acids 10 to 314 (305 residues), 517.9 bits, see alignment E=4.5e-160 PF03279: Lip_A_acyltrans" amino acids 12 to 305 (294 residues), 384.2 bits, see alignment E=2e-119

Best Hits

Swiss-Prot: 100% identical to LPXM_ECOLI: Lipid A biosynthesis myristoyltransferase (lpxM) from Escherichia coli (strain K12)

KEGG orthology group: K02560, lipid A biosynthesis (KDO)2-(lauroyl)-lipid iva acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to eco:b1855)

MetaCyc: 100% identical to Lipid A biosynthesis myristoyltransferase (Escherichia coli K-12 substr. MG1655)
MYRISTOYLACYLTRAN-RXN [EC: 2.3.1.243]; 2.3.1.243 [EC: 2.3.1.243]

Predicted SEED Role

"Lipid A biosynthesis (KDO) 2-(lauroyl)-lipid IVA acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.243

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>BNILDI_15545 lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase (Escherichia coli ECRC62)
METKKNNSEYIPEFDKSFRHPRYWGAWLGVAAMAGIALTPPKFRDPILARLGRFAGRLGK
SSRRRALINLSLCFPERSEAEREAIVDEMFATAPQAMAMMAELAIRGPEKIQPRVDWQGL
EIIEEMRRNNEKVIFLVPHGWAVDIPAMLMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF
GGRLHARNDGIKPFIQSVRQGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVC
RARVVPLFPIYDGKTHHLTIQVRPPMDDLLEADDHTIARRMNEEVEIFVGPRPEQYTWIL
KLLKTRKPGEIQPYKRKDLYPIK