Protein Info for BNILDI_15260 in Escherichia coli ECRC62

Name: yecA
Annotation: UPF0149 family protein YecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR02292: yecA family protein" amino acids 10 to 182 (173 residues), 185 bits, see alignment E=4.8e-59 PF03695: UPF0149" amino acids 12 to 183 (172 residues), 130.1 bits, see alignment E=1.1e-41 PF02810: SEC-C" amino acids 203 to 220 (18 residues), 40.3 bits, see alignment (E = 2.3e-14)

Best Hits

Swiss-Prot: 100% identical to YECA_SHIFL: Uncharacterized protein YecA (yecA) from Shigella flexneri

KEGG orthology group: K07039, uncharacterized protein (inferred from 100% identity to eco:b1908)

Predicted SEED Role

"FIG00637942: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>BNILDI_15260 UPF0149 family protein YecA (Escherichia coli ECRC62)
MKTGPLNESELEWLDDILTKYNTDHAILDVAELDGLLTAVLSSPQEIEPEQWLVAVWGGA
DYVPRWASEKEMTRFMNLAFQHMADTAERLNEFPEQFEPLFGLREVDGSELTIVEEWCFG
YMRGVALSDWSTLPDSLKPALEAIALHGTEENFERVEKMSPEAFEESVDAIRLAALDLHA
YWMAHPQEKAVQQPIKAEEKPGRNDPCPCGSGKKFKQCCLH