Protein Info for BNILDI_15090 in Escherichia coli ECRC62

Name: fliO
Annotation: flagellar type III secretion system protein FliO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 25 to 93 (69 residues), 79.5 bits, see alignment E=7.3e-27 PF04347: FliO" amino acids 37 to 116 (80 residues), 71.8 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 100% identical to FLIO_ECOLI: Flagellar protein FliO (fliO) from Escherichia coli (strain K12)

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 100% identity to eco:b1947)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>BNILDI_15090 flagellar type III secretion system protein FliO (Escherichia coli ECRC62)
MNNHATVQSSAPVSAAPLLQVSGALIAIIALILAAAWLVKRLGFAPKRTGVNGLKISASA
SLGARERVVVVDVEDARLVLGVTAGQINLLHKLPPSAPTEEIPQTDFQSVMKNLLKRSGR
S