Protein Info for BNILDI_14975 in Escherichia coli ECRC62

Name: msrP
Annotation: protein-methionine-sulfoxide reductase catalytic subunit MsrP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00174: Oxidored_molyb
  • amino acids 89 to 248 (160 residues), 114.1 bits, E=2.6e-37

Best Hits

Swiss-Prot: 100% identical to MSRP_ECO24: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K07147, (no description) (inferred from 98% identity to ecj:JW1954)

MetaCyc: 98% identical to protein-L-methionine sulfoxide reductase catalytic subunit MsrP (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Protein Sequence (315 amino acids)

>BNILDI_14975 protein-methionine-sulfoxide reductase catalytic subunit MsrP (Escherichia coli ECRC62)
MKRRQVLKALGISAAALSLPHAAHADLLSWFKGNDRPPAPAGKPLEFSKPAAWQNNLPLT
PVDKVSGYNNFYEFGLDKADPAANAGSLKTDPWTLKISGEVAKPLTLDHDDLTRRFPLEE
RIYRMRCVEAWSMVVPWIGFPLHKLLALAEPTSNAKYVAFETIYAPEQMPGQQDRFIGGG
LKYPYVEGLRLDEAMHPLTLMTVGVYGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLT
RERPPTTWNLAAPDEYGFYANVNPHVDHPRWSQATERFIGSGGILDVQRQPTLLFNGYAD
QVASLYRGLDLRENF