Protein Info for BNILDI_14660 in Escherichia coli ECRC62

Name: wzy
Annotation: O23 family O-antigen polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 114 to 145 (32 residues), see Phobius details amino acids 151 to 178 (28 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details PF14897: EpsG" amino acids 26 to 325 (300 residues), 128.6 bits, see alignment E=1.5e-41

Best Hits

Predicted SEED Role

"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>BNILDI_14660 O23 family O-antigen polymerase (Escherichia coli ECRC62)
MLIYNTIFVFLSFLALLDLSHKKNLLFFLFPCFILLLLTAIRGNGGDDFYVYEKYFNALP
NEIFNYGYGYYSLNMFVKNFGEYPFFIIISSIICITLQAIFIYRETEKPTLVLFLFYSTS
FLWLDFILIRQSISVGFFILAISFFKNNKKIFACLFLILSSLFHETAIFAGVVFYILYRA
EKAGFLFTIGSVLIIAPFLSDIITIINDMTIKNNNITLYLEQRTLPSIANVVELTIAFVA
FYIINKNSVFRESNEYKIYKSILYSSLCILLLSYTIPSLARFLEFFRFFYFILVVRMLMQ
FNVRSRYLFFVIILAYCFMRLNSFINQFDSGFDYIYNGKIL