Protein Info for BNILDI_14615 in Escherichia coli ECRC62

Name: cpsG
Annotation: colanic acid biosynthesis phosphomannomutase CpsG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF02878: PGM_PMM_I" amino acids 7 to 131 (125 residues), 115.3 bits, see alignment E=3.5e-37 PF02879: PGM_PMM_II" amino acids 153 to 258 (106 residues), 80.8 bits, see alignment E=1.9e-26 PF02880: PGM_PMM_III" amino acids 263 to 372 (110 residues), 99.1 bits, see alignment E=3.6e-32 PF00408: PGM_PMM_IV" amino acids 378 to 439 (62 residues), 31.9 bits, see alignment E=2.3e-11

Best Hits

Swiss-Prot: 99% identical to MANB_ECOLI: Phosphomannomutase (manB) from Escherichia coli (strain K12)

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 99% identity to eco:b2048)

MetaCyc: 99% identical to phosphomannomutase (Escherichia coli K-12 substr. MG1655)
Phosphomannomutase. [EC: 5.4.2.8]

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>BNILDI_14615 colanic acid biosynthesis phosphomannomutase CpsG (Escherichia coli ECRC62)
MKKLTCFKAYDIRGKLGEELNEDIAWRIGRAYGEFLKPKTIVLGGDVRLTSETLKLALAK
GLQDAGVDVLDIGMSGTEEIYFATFHLGVDGGIEVTASHNPMDYNGMKLVREEARPISGD
TGLRDVQRLAEANDFPPVDETKRGRYQQITLRDAYVDHLFGYINVKNLMPLKLVINSGNG
AAGPVVDAIEARFKALGAPVELIKVHNTPDGNFPNGIPNPLLPECRDDTRNAVIKHGADM
GIAFDGDFDRCFLFDEKGQFIEGYYIVGLLAEAFLEKNPGAKIIHDPRLSWNTVDVVTTA
GGTPVMSKTGHAFIKERMRKEDAIYGGEMSAHHYFRDFAYCDSGMIPWLLVAELVCLKEK
TLGELVRDRMAAFPASGEINSKLAQPVEAINRVEQHFSREALAVDRTDGISMTFADWRFN
LRTSNTEPVVRLNVESRGDVPLMEARTRTLLTLLNE