Protein Info for BNILDI_14580 in Escherichia coli ECRC62

Name: wcaF
Annotation: colanic acid biosynthesis acetyltransferase WcaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 23 to 40 (18 residues), see Phobius details TIGR04008: colanic acid biosynthesis acetyltransferase WcaF" amino acids 1 to 180 (180 residues), 401.2 bits, see alignment E=2.7e-125 PF00132: Hexapep" amino acids 125 to 157 (33 residues), 30.2 bits, see alignment 1.3e-11

Best Hits

Swiss-Prot: 100% identical to WCAF_SHIFL: Putative colanic acid biosynthesis acetyltransferase WcaF (wcaF) from Shigella flexneri

KEGG orthology group: K03818, putative colanic acid biosynthesis acetyltransferase WcaF [EC: 2.3.1.-] (inferred from 100% identity to eco:b2054)

MetaCyc: 100% identical to colanic acid biosynthesis acetyltransferase WcaF (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Colanic acid biosynthesis acetyltransferase WcaF (EC 2.3.1.-)" in subsystem Colanic acid biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>BNILDI_14580 colanic acid biosynthesis acetyltransferase WcaF (Escherichia coli ECRC62)
MQDLSGFSVPKGFRGGNAIKVQLWWAVQATIFAWSPQVLYRWRAFLLRLFGAKIGKNVVI
RPSVKITYPWKLTLGDYAWVGDDVNLYTLGEITIGAHSVISQKSYLCTGSHDHASQHFTI
NATPIVIGEKCWLATDVFVAPGVTIGDGTVVGARSSVFKSLPANVVCRGNPAVVIRERVE
TE