Protein Info for BNILDI_14165 in Escherichia coli ECRC62

Name: yehW
Annotation: glycine betaine ABC transporter permease YehW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 47 to 75 (29 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details amino acids 118 to 144 (27 residues), see Phobius details amino acids 164 to 189 (26 residues), see Phobius details amino acids 201 to 227 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 68 to 239 (172 residues), 95.8 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 100% identical to YEHW_ECOLI: Glycine betaine uptake system permease protein YehW (yehW) from Escherichia coli (strain K12)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 100% identity to eco:b2128)

MetaCyc: 100% identical to glycine betaine ABC transporter membrane subunit YehW (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-283

Predicted SEED Role

"Osmoprotectant ABC transporter inner membrane protein YehW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>BNILDI_14165 glycine betaine ABC transporter permease YehW (Escherichia coli ECRC62)
MKMLRDPLFWLIALFVALIFWLPYSQPLFAALFPQLPRPVYQQESFAALALAHFWLVGIS
SLFAVIIGTGAGIAVTRPWGAEFRPLVETIAAVGQTFPPVAVLAIAVPVIGFGLQPAIIA
LILYGVLPVLQATLAGLGAIDASVTEVAKGMGMSRGQRLRKVELPLAAPVILAGVRTSVI
INIGTATIASTVGASTLGTPIIIGLSGFNTAYVIQGALLVALAAIIADRLFERLVQALSQ
HAK