Protein Info for BNILDI_14015 in Escherichia coli ECRC62

Name: yeiB
Annotation: Uncharacterized protein YeiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 48 to 72 (25 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 123 (17 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details PF04235: DUF418" amino acids 215 to 374 (160 residues), 161.7 bits, see alignment E=7.7e-52

Best Hits

Swiss-Prot: 99% identical to YEIB_ECOLI: Uncharacterized protein YeiB (yeiB) from Escherichia coli (strain K12)

KEGG orthology group: K07148, uncharacterized protein (inferred from 99% identity to eco:b2152)

Predicted SEED Role

"FIG00924762: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>BNILDI_14015 Uncharacterized protein YeiB (Escherichia coli ECRC62)
MERNVTLDFVRGVAILGILLLNISAFGLPKAAYLNPAWYGAITPQDAWTWAFLDLIAQVK
FLTLFALLFGAGLQMLLPRGRRWIQSRLTLLVLLGFIHGLLFWDGDILLAYGLVGLICWR
LVRDAPSVKSLFNTGVMLYLVGLGVLLLLGLISDSQTSRAWTPDASAILYEKYWKLHGGV
DAISNRADGVGNSLLALGAQYGWQLAGMMLIGAALMRSGWLKGQFSLRHYRRTGFVLVAI
GVTINLPAIALQWQLDWAYRWCAFLLQMPRELSAPFQAIGYASLFYGFWPQLSRFKLVLA
IACVGRMALTNYLLQTLICTTLFYHLGLFMHFDRLELLAFVIPVWLANILFSVIWLRYFR
QGPVEWLWRQLTLRAAGTAISKTSR