Protein Info for BNILDI_13435 in Escherichia coli ECRC62

Name: nuoM
Annotation: NADH-quinone oxidoreductase subunit M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 77 to 103 (27 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details amino acids 417 to 440 (24 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 3 to 499 (497 residues), 617.2 bits, see alignment E=9.9e-190 PF00361: Proton_antipo_M" amino acids 134 to 429 (296 residues), 235.6 bits, see alignment E=3.7e-74

Best Hits

Swiss-Prot: 100% identical to NUOM_ECO57: NADH-quinone oxidoreductase subunit M (nuoM) from Escherichia coli O157:H7

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 100% identity to eco:b2277)

MetaCyc: 100% identical to NADH:quinone oxidoreductase subunit M (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>BNILDI_13435 NADH-quinone oxidoreductase subunit M (Escherichia coli ECRC62)
MLLPWLILIPFIGGFLCWQTERFGVKVPRWIALITMGLTLALSLQLWLQGGYSLTQSAGI
PQWQSEFDMPWIPRFGISIHLAIDGLSLLMVVLTGLLGVLAVLCSWKEIEKYQGFFHLNL
MWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQA
SGLVMLIAILALVFVHYNATGVWTFNYEELLNTPMSSGVEYLLMLGFFIAFAVKMPVVPL
HGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPNASAEFAPIAMWLGVIGIFY
GAWMAFAQTDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAAGLFILCG
QLYERIHTRDMRMMGGLWSKMKWLPALSLFFAVATLGMPGTGNFVGEFMILFGSFQVVPV
ITVISTFGLVFASVYSLAMLHRAYFGKAKSQIASQELPGMSLRELFMILLLVVLLVLLGF
YPQPILDTSHSAIGNIQQWFVNSVTTTRP