Protein Info for BNILDI_12990 in Escherichia coli ECRC62

Name: dsdX
Annotation: D-serine transporter DsdX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details PF02447: GntP_permease" amino acids 2 to 71 (70 residues), 76.5 bits, see alignment E=9.4e-26

Best Hits

Swiss-Prot: 99% identical to DSDX_SHIFL: Putative D-serine transporter DsdX-like protein (dsdX) from Shigella flexneri

KEGG orthology group: None (inferred from 97% identity to ecp:ECP_2390)

Predicted SEED Role

"D-serine permease DsdX" in subsystem Glycine and Serine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>BNILDI_12990 D-serine transporter DsdX (Escherichia coli ECRC62)
VLPLYPDISPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGATLNETFKYYTTATFIASVV
ALAGTFLLSFII