Protein Info for BNILDI_12890 in Escherichia coli ECRC62

Annotation: Phosphoenolpyruvate--protein phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 5 to 331 (327 residues), 387 bits, see alignment E=1.3e-119 PF02896: PEP-utilizers_C" amino acids 17 to 307 (291 residues), 371.6 bits, see alignment E=2.7e-115 TIGR00848: PTS system, fructose subfamily, IIA component" amino acids 344 to 469 (126 residues), 141 bits, see alignment E=1.9e-45 PF00359: PTS_EIIA_2" amino acids 344 to 483 (140 residues), 115.3 bits, see alignment E=2.2e-37

Best Hits

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)" in subsystem Fructose and Mannose Inducible PTS or Fructose utilization or Mannitol Utilization (EC 2.7.3.9)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.9

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>BNILDI_12890 Phosphoenolpyruvate--protein phosphotransferase (Escherichia coli ECRC62)
VSGYYQVAQTLADKRQKQQAQAAAQLAYSRDNKRIDIAANIGTALEAPGAFANGAEGVGL
FRTEMLYMDRDSAPDEQEQFEAYQQVLLAAGDKPIIFRTMDIGGDKSIPYLNIPQEENPF
LGYRAVRIYPEFAGLFRTQLRAILRAASFGNAQLMIPMVHSLDQILWVKGEIQKAIVELK
RDGLRHAETITLGIMVEVPSVCYIIDHFCDEVDFFSIGSNDMTQYLYAVDRNNPRVSPLY
NPITPSFLRMLQQIVTTAHQRGKWVGICGELGGESRYLPLLLGLGLDELSMSSPRIPAVK
SQLRQLDSEACRELARQACECRSAQEIEALLTAFTPEEDVRPLLALENIFVDQDFSNKEQ
AIQFLCGNLGVNGRTEHPFELEEDVWQREEIVTTGVGFGVAIPHTKSQWIRHSSISIARL
AKPIDWQSEMGEVELVIMLTLGANEGMNHVKVFSQLARKLVNKNFRQSLFAAQDAQSILT
LLETELTF