Protein Info for BNILDI_12885 in Escherichia coli ECRC62

Annotation: Multiphosphoryl transfer protein 1 [includes phosphoenolpyruvate-protein phosphotransferasephosphocarrier protein Hp fructose-like phosphotransferase enzyme IIA component]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00381: PTS-HPr" amino acids 6 to 84 (79 residues), 53.6 bits, see alignment E=2.9e-18 PF05524: PEP-utilisers_N" amino acids 119 to 234 (116 residues), 50.7 bits, see alignment E=3e-17 PF00391: PEP-utilizers" amino acids 261 to 334 (74 residues), 54 bits, see alignment E=1.6e-18

Best Hits

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)" in subsystem Fructose and Mannose Inducible PTS or Fructose utilization or Mannitol Utilization (EC 2.7.3.9)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.9

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>BNILDI_12885 Multiphosphoryl transfer protein 1 [includes phosphoenolpyruvate-protein phosphotransferasephosphocarrier protein Hp fructose-like phosphotransferase enzyme IIA component] (Escherichia coli ECRC62)
MLTIQFLCPLPNGLHARPAWELKEQCSQWQSEVTFINHRQNAKADAKSSLALIGTGTLFN
DSCSLNISGSDEEQARRVLEEYIQVRFIDSDSVQPTQAELTAHPLPRSLSRLNPDLLYGN
VLASGVGVGTLTLLQSDSLDSYRAIPASVQDSTRLEHSLATLAEQLNQQLRERDGESKTI
LSAHLSLIQDDEFAGNIRRLMTEQHQGLGAAIISNMEQVCAKLSASASDYLRERVSDIRD
ISEQLLHITWPELKPRNNLVLEKPTILVAEDLTPSQFLSLDLKNLAGMILEKTGRTSHTL
ILARASAIPVLSGLPLDAIARYAGQPAVLDAQCGVLAINPMTR