Protein Info for BNILDI_12815 in Escherichia coli ECRC62

Name: yfeC
Annotation: Uncharacterized protein YfeC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF07037: YfeC-like" amino acids 6 to 118 (113 residues), 172.7 bits, see alignment E=1.8e-55

Best Hits

Swiss-Prot: 100% identical to YFEC_ECOL6: Uncharacterized protein YfeC (yfeC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to ecg:E2348C_2587)

Predicted SEED Role

"Putative negative regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>BNILDI_12815 Uncharacterized protein YfeC (Escherichia coli ECRC62)
MFKERMTPDELARLTGYSRQTINKWVRKEGWTTSPKPGVQGGKARLVHVNEQVREYIRNA
ERPEGQGEAPALSGDAPLEVLLVTLAKEMTPVEQKQFTSLLLREGIIGLLQRLGIRDSK