Protein Info for BNILDI_12705 in Escherichia coli ECRC62

Name: cysW
Annotation: sulfate/thiosulfate ABC transporter permease CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 65 to 90 (26 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 2 to 275 (274 residues), 384.3 bits, see alignment E=3.2e-119 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 19 to 276 (258 residues), 371.8 bits, see alignment E=1.9e-115 PF00528: BPD_transp_1" amino acids 81 to 267 (187 residues), 53.8 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 100% identical to CYSW_ECOL6: Sulfate transport system permease protein CysW (cysW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to eco:b2423)

MetaCyc: 100% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>BNILDI_12705 sulfate/thiosulfate ABC transporter permease CysW (Escherichia coli ECRC62)
MAEVTQLKRYDARPINWGKWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADP
DMLHAIWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLV
YLLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAA
ILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIE
LLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEKRAQQEEHHEH